| Edit |   |
| Antigenic Specificity | Chromosome 21 Open Reading Frame 58 (C21orf58) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of Chromosome 21 ORF protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | C21 orf58 antibody was raised using the N terminal of C21 rf58 corresponding to a region with amino acids MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW |
| Other Names | n/a |
| Gene, Accession # | Gene ID: 54058 |
| Catalog # | ABIN633031 |
| Price | |
| Order / More Info | Chromosome 21 Open Reading Frame 58 (C21orf58) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |