| Edit |   |
| Antigenic Specificity | Chromosome 5 Open Reading Frame 35 (C5orf35) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of C5orf35 has not been widely studied, and is yet to be fully elucidated. |
| Immunogen | C5 ORF35 antibody was raised using the N terminal Of C5 rf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL |
| Other Names | DKFZp468C1120|C5orf35 |
| Gene, Accession # | Gene ID: 133383 |
| Catalog # | ABIN632765 |
| Price | |
| Order / More Info | Chromosome 5 Open Reading Frame 35 (C5orf35) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |