| Edit |   |
| Antigenic Specificity | Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation. |
| Immunogen | C5 ORF39 antibody was raised using the N terminal Of C5 rf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
| Other Names | AX2R|AXIIR|C5orf39 |
| Gene, Accession # | Gene ID: 389289 |
| Catalog # | ABIN630761 |
| Price | |
| Order / More Info | Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |