| Edit |   |
| Antigenic Specificity | Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated. |
| Immunogen | C6 orf134 antibody was raised using the N terminal of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL |
| Other Names | C23H6orf134|C6orf134|MEC17|Nbla00487|TAT|3110080J08Rik|Mec17|RGD1303066|0610011P08Rik|2610008K08Rik|2610110G12Rik|C7H6ORF134|Alpha-TAT|c6orf134|mec17|C4H6orf134|wu:fj19c03|zgc:65893|zgc:77443 |
| Gene, Accession # | Gene ID: 79969 |
| Catalog # | ABIN632487 |
| Price | |
| Order / More Info | Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |