| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. |
|---|
| Immunogen | SLC27 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL |
|---|
| Other Names | SLC27A4|zgc:112138|FATP4|ACSVL4|IPS|BB144259|Fatp4 |
|---|
| Gene, Accession # | Gene ID: 10999 |
|---|
| Catalog # | ABIN635777 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|