| Edit |   |
| Antigenic Specificity | Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. |
| Immunogen | SLC27 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD |
| Other Names | SLC27A5|ARTD9|BAL|BAL1|MGC:7868|rBAL-1|ACSB|ACSVL6|BACS|FACVL3|FATP-5|FATP5|VLACSR|VLCS-H2|VLCSH2|Vlacsr |
| Gene, Accession # | Gene ID: 10998 |
| Catalog # | ABIN636073 |
| Price | |
| Order / More Info | Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |