| Edit |   |
| Antigenic Specificity | Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate. |
| Immunogen | SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP |
| Other Names | LOC100226745|CHMD|FOLT|IFC1|REFC|RFC1|AI323572|RFC|RFC-1|MTX1 |
| Gene, Accession # | Gene ID: 6573 |
| Catalog # | ABIN630376 |
| Price | |
| Order / More Info | Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |