| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. |
|---|
| Immunogen | SLC1 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK |
|---|
| Other Names | CG3159|Dmel\\CG3159|EAAT|dEAAT2|dEaat2|Eaat|GB16377|EAAT2|SLC1A2|Eaat2|Glt|Glt-1|GLT-1|1700091C19Rik|2900019G14Rik|AI159670|GLT1|MGLT1|eaat2|fj34b12|slc1a2|wu:fj34b12|zgc:65897 |
|---|
| Gene, Accession # | Gene ID: 6506,20511,29482 |
|---|
| Catalog # | ABIN635115 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|