| Edit |   |
| Antigenic Specificity | Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice. |
| Immunogen | TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES |
| Other Names | Aint|C86661|Eric1|ERIC-1|ERIC1|maskin|masking|xmaskin |
| Gene, Accession # | Gene ID: 10460 |
| Catalog # | ABIN633120 |
| Price | |
| Order / More Info | Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |