| Edit |   |
| Antigenic Specificity | Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. |
| Immunogen | IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL |
| Other Names | Ifgr2|Ifgt|AF-1|IFGR2|IFNGT1 |
| Gene, Accession # | Gene ID: 3460 |
| Catalog # | ABIN635275 |
| Price | |
| Order / More Info | Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |