| Edit |   |
|---|
| Antigenic Specificity | S100A2 (full length) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse Anti-Human S100A2 (full length) polyclonal antibody for WB. |
|---|
| Immunogen | Full length protein corresponding to Human S100 alpha 2 aa 1-97.Sequence: MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKV DEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP Database link: AAH02829 |
|---|
| Other Names | S100A2; S100 calcium binding protein A2; CAN19; S100L; protein S100-A2; S100 calcium-binding protein A2; |
|---|
| Gene, Accession # | S100A2, Gene ID: 6273, UniProt: P29034 |
|---|
| Catalog # | DPABH-09712 |
|---|
| Price | |
|---|
| Order / More Info | S100A2 (full length) Antibody from CREATIVE DIAGNOSTICS |
|---|
| Product Specific References | n/a |
|---|