| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | TSPAN7 |
| Clone | CL0262 |
| Host Species | Mouse |
| Reactive Species | human, mouse |
| Isotype | IgG1 |
| Format | purified |
| Size | n/a |
| Concentration | n/a |
| Applications | IHC, IHC-P, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse Anti-TSPAN7 Monoclnal Antibody (CL0262). Provided herein is a mouse monoclonal antibody against Human TSPAN7. The antibody, clone CL0262, can be used for immunoassay techniques, such as IHC, IHC-P and WB. TSPAN7 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. |
| Immunogen | A recombinant protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET |
| Other Names | A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b; DXS1692E |
| Gene, Accession # | Gene ID: 7102, UniProt: P41732 |
| Catalog # | CBMAB-1667-YC |
| Price | |
| Order / More Info | TSPAN7 Antibody from CREATIVE BIOLABS |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|