| Edit |   |
| Antigenic Specificity | CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. |
| Immunogen | CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ |
| Other Names | cdc42ep4|zgc:91889|wu:fb55a05|cep4|borg4|kaia1777|BORG4|CEP4|KAIA1777|1500041M20Rik|Borg4 |
| Gene, Accession # | Gene ID: 23580,56699 |
| Catalog # | ABIN631473 |
| Price | |
| Order / More Info | CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |