| Edit |   |
| Antigenic Specificity | KCNJ2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 98%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human KCNJ2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES |
| Other Names | potassium inwardly-rectifying channel, subfamily J, member 2, IRK1, Kir2.1, LQT7 |
| Gene, Accession # | Gene ID: 3759, UniProt: P63252, ENSG00000123700 |
| Catalog # | HPA029109 |
| Price | |
| Order / More Info | KCNJ2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |