| Edit |   |
| Antigenic Specificity | Solute Carrier Family 35, Member C1 (SLC35C1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen. |
| Immunogen | SLC35 C1 antibody was raised using the N terminal of SLC35 1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG |
| Other Names | GDP-Fuc-Tr|SLC35C1|wu:fc03b12|zgc:101867|CDG2C|FUCT1|E430007K15Rik|fuct1 |
| Gene, Accession # | Gene ID: 55343 |
| Catalog # | ABIN630296 |
| Price | |
| Order / More Info | Solute Carrier Family 35, Member C1 (SLC35C1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |