| Edit |   |
| Antigenic Specificity | CUGBP, Elav-Like Family Member 5 (CELF5) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene. |
| Immunogen | BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP |
| Other Names | BRUNOL-5|BRUNOL5|CELF-5|4930565A21Rik|Brunol5|RGD1565016 |
| Gene, Accession # | Gene ID: 60680 |
| Catalog # | ABIN633506 |
| Price | |
| Order / More Info | CUGBP, Elav-Like Family Member 5 (CELF5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |