| Edit |   |
|---|
| Antigenic Specificity | CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear. |
|---|
| Immunogen | CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV |
|---|
| Other Names | CUGBP2|BRUNOL3|ETR-3|ETR3|NAPOR|B230218O03|B230345P09Rik|C88023|CELF-2|CUG-BP2|Cugbp2|D230046B21Rik|Etr-3|Napor|Napor-2|mETR-3|cb906|cugbp2|fj87b07|wu:fj87b07|brunol3|celf2|cugbp2-a|etr3|napor|Brunol3|Etr3 |
|---|
| Gene, Accession # | Gene ID: 10659 |
|---|
| Catalog # | ABIN633459 |
|---|
| Price | |
|---|
| Order / More Info | CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|