| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Immunogen | CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids NIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSP |
| Other Names | CUGBP2|BRUNOL3|ETR-3|ETR3|NAPOR|B230218O03|B230345P09Rik|C88023|CELF-2|CUG-BP2|Cugbp2|D230046B21Rik|Etr-3|Napor|Napor-2|mETR-3|cb906|cugbp2|fj87b07|wu:fj87b07|brunol3|celf2|cugbp2-a|etr3|napor|Brunol3|Etr3 |
| Gene, Accession # | Gene ID: 10659,14007,29428 |
| Catalog # | ABIN633392 |
| Price | |
| Order / More Info | CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|