| Edit |   |
|---|
| Antigenic Specificity | PEA15 (full length) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse anti-Human PEA15 (full length) polyclonal antibody for WB. |
|---|
| Immunogen | Full length protein corresponding to Human PEA15 aa 1-74.Sequence: MYIKTALPCLPFFVVSSINLLSRPERGWEGNATVKGVAESSCYIVQTKKK AFSKNIKFTCSLRDYLDKVQVRSFDatabase link: AAH10469.1 |
|---|
| Other Names | PEA15; phosphoprotein enriched in astrocytes 15; astrocytic phosphoprotein PEA-15; HMAT1; homolog of mouse MAT 1 oncogene; HUMMAT1H; MAT1; MAT1H; PEA 15; PED; Phosphoprotein enriched in astrocytes; 15kD; homolog of mouse MAT-1 oncogene; phosphoprotein enriched in diabetes; Phosphoprotein enriched in astrocytes, 15kD; 15 kDa phosphoprotein enriched in astrocytes; PEA-15; |
|---|
| Gene, Accession # | PEA15, Gene ID: 8682, UniProt: Q15121 |
|---|
| Catalog # | DPABH-08201 |
|---|
| Price | |
|---|
| Order / More Info | PEA15 (full length) Antibody from CREATIVE DIAGNOSTICS |
|---|
| Product Specific References | n/a |
|---|