If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.
Immunogen
CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS