| Edit |   |
| Antigenic Specificity | Multiple PDZ Domain Protein (MPDZ) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses. |
| Immunogen | MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI |
| Other Names | HYC2|MUPP1|AI225843|B930003D11Rik |
| Gene, Accession # | Gene ID: 8777,17475,29365 |
| Catalog # | ABIN630839 |
| Price | |
| Order / More Info | Multiple PDZ Domain Protein (MPDZ) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |