If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for HTRA1 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.
Immunogen
A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).