If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Serine protease HTRA3(HTRA3) detection. Tested with WB in Human. No cross reactivity with other proteins. Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.