| Edit |   |
| Antigenic Specificity | Mov10, Moloney Leukemia Virus 10, Homolog (Mouse) (MOV10) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | MOV10 may be an helicase with an important function in development and/or control of cell proliferation. |
| Immunogen | MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR |
| Other Names | C77703|Mov-10|Capza1|fSAP113|gb110 |
| Gene, Accession # | Gene ID: 4343 |
| Catalog # | ABIN629879 |
| Price | |
| Order / More Info | Mov10, Moloney Leukemia Virus 10, Homolog (Mouse) (MOV10) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |