| Edit |   |
| Antigenic Specificity | WBP2 N-terminal Like (WBP2NL) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization. |
| Immunogen | WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT |
| Other Names | pawp|PAWP|4930521I23Rik |
| Gene, Accession # | Gene ID: 164684 |
| Catalog # | ABIN630989 |
| Price | |
| Order / More Info | WBP2 N-terminal Like (WBP2NL) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |