| Edit |   |
| Antigenic Specificity | Fructose-1,6-Bisphosphatase 2 (FBP2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. |
| Immunogen | FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ |
| Other Names | FBP2|MGC108013|FBP|Fbp-1|Fbp1|Rae-30|zgc:101083|FBPase|6330409F21Rik|Fbp2|Fubp2|Ksrp |
| Gene, Accession # | Gene ID: 8789 |
| Catalog # | ABIN631953 |
| Price | |
| Order / More Info | Fructose-1,6-Bisphosphatase 2 (FBP2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |