| Edit |   |
| Antigenic Specificity | Kelch-Like 15 (Drosophila) (KLHL15) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization. |
| Immunogen | KLHL15 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC |
| Other Names | 6330500C13Rik|wu:fa66h10|zgc:101051|RGD1563101 |
| Gene, Accession # | Gene ID: 80311,236904,314111 |
| Catalog # | ABIN631407 |
| Price | |
| Order / More Info | Kelch-Like 15 (Drosophila) (KLHL15) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |