| Edit |   |
| Antigenic Specificity | Kelch-Like 32 (Drosophila) (KLHL32) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The specific function of KLHL32 is not yet known. |
| Immunogen | KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT |
| Other Names | 6430524H05Rik|D4Ertd389e|Gm1356|mKIAA1900|zgc:158866|BKLHD5|KIAA1900|UG0030H05|dJ21F7.1|RGD1310364 |
| Gene, Accession # | Gene ID: 114792,212390,313111 |
| Catalog # | ABIN631778 |
| Price | |
| Order / More Info | Kelch-Like 32 (Drosophila) (KLHL32) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |