| Edit |   |
| Antigenic Specificity | Kelch-Like 7 (Drosophila) (KLHL7) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown. |
| Immunogen | KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV |
| Other Names | 2700038B03Rik|D5Ertd363e|SBBI26|KLHL6 |
| Gene, Accession # | Gene ID: 55975,52323,362303 |
| Catalog # | ABIN632426 |
| Price | |
| Order / More Info | Kelch-Like 7 (Drosophila) (KLHL7) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |