| Edit |   |
| Antigenic Specificity | Kelch-Like 2, Mayven (Drosophila) (KLHL2) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells. |
| Immunogen | KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN |
| Other Names | 6030411N21Rik|ABP-KELCH|AU020744|Mav|mKIAA4249|MAV|MAYVEN |
| Gene, Accession # | Gene ID: 11275 |
| Catalog # | ABIN633041 |
| Price | |
| Order / More Info | Kelch-Like 2, Mayven (Drosophila) (KLHL2) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |