| Edit |   |
|---|
| Antigenic Specificity | Kelch-Like 2, Mayven (Drosophila) (KLHL2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells. |
|---|
| Immunogen | KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN |
|---|
| Other Names | 6030411N21Rik|ABP-KELCH|AU020744|Mav|mKIAA4249|MAV|MAYVEN |
|---|
| Gene, Accession # | Gene ID: 11275 |
|---|
| Catalog # | ABIN633041 |
|---|
| Price | |
|---|
| Order / More Info | Kelch-Like 2, Mayven (Drosophila) (KLHL2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|