| Edit |   |
| Antigenic Specificity | Ribosomal Protein L30 (RPL30) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron. |
| Immunogen | RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA |
| Other Names | BcDNA:RE25263|BcDNA:RH09938|CG10652|Dmel\\CG10652|L30|RPL30|Rp L30|Rpl30|anon-EST:fe1D4|l(2)01265|l(2)SH0229|l(2)SH2 0229|l(2)k09918|plume|fa93d05|wu:fa93d05|zgc:56640|zgc:77683 |
| Gene, Accession # | Gene ID: 6156,19946,64640 |
| Catalog # | ABIN630571 |
| Price | |
| Order / More Info | Ribosomal Protein L30 (RPL30) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |