| Edit |   |
| Antigenic Specificity | Ribosomal Protein L5 (RPL5) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, Arabidopsis, Drosophila |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA. |
| Immunogen | RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP |
| Other Names | DBA6|L5|U21RNA|CG17489|Dmel\\CG17489|E-2d|M(2)40B|Rp L5|Rpl5|dRPL5|yip6|rpl5|wu:fj02g05|zgc:86854 |
| Gene, Accession # | Gene ID: 3355124,6125,100503670,81763 |
| Catalog # | ABIN633202 |
| Price | |
| Order / More Info | Ribosomal Protein L5 (RPL5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |