| Edit |   |
| Antigenic Specificity | Microfibrillar-Associated Protein 4 (MFAP4) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region. |
| Immunogen | MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK |
| Other Names | 1110007F23Rik|Magp-36|zgc:77076 |
| Gene, Accession # | Gene ID: 4239,287382 |
| Catalog # | ABIN634642 |
| Price | |
| Order / More Info | Microfibrillar-Associated Protein 4 (MFAP4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |