| Edit |   |
| Antigenic Specificity | Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown. |
| Immunogen | ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH |
| Other Names | LRRC62|PPP1R29|dJ63G5.3|Elfn2|RGD1559693|6330514E13|AW048948|BC094219|Lrrc62|Ppp1r29 |
| Gene, Accession # | Gene ID: 114794,207393,315117 |
| Catalog # | ABIN635494 |
| Price | |
| Order / More Info | Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |