| Edit |   |
| Antigenic Specificity | Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. |
| Immunogen | PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS |
| Other Names | PTGIS|Cyp8|Cyp8a1|Pgis|PGIS|CYP8|CYP8A1|PTGI|ptgisl |
| Gene, Accession # | Gene ID: 5740,19223,25527 |
| Catalog # | ABIN635828 |
| Price | |
| Order / More Info | Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |