| Edit |   |
| Antigenic Specificity | GPX8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 70%, rat 70%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GPX8 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII |
| Other Names | glutathione peroxidase 8 (putative), EPLA847, UNQ847 |
| Gene, Accession # | Gene ID: 493869, UniProt: Q8TED1, ENSG00000164294 |
| Catalog # | HPA036720 |
| Price | |
| Order / More Info | GPX8 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |