| Edit |   |
| Antigenic Specificity | CDC42EP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 94%, rat 94%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human CDC42EP3 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA |
| Other Names | CDC42 effector protein 3, BORG2, CEP3, UB1 |
| Gene, Accession # | Gene ID: 10602, UniProt: Q9UKI2, ENSG00000163171 |
| Catalog # | HPA061792 |
| Price | |
| Order / More Info | CDC42EP3 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |