| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. |
| Immunogen | ATP6 V6 antibody was raised using the middle region of ATP6 6 corresponding to a region with amino acids VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG |
| Other Names | Atp6c3|Atpl-rs2|Atp6c-rs2|CHUNP6904|atp6l|atp6v0c|cb993|fb57d09|wu:fb57d09|atp6c|atpl|ductin|vatl|vma3|Atp6c|Atp6c1|Atp6c2|Atp6c-rs1|Atp6l-ps1|Atp6l-ps2|Gm15487|ATP6C|ATP6L|ATPL|VATL|VPPC|Vma3|PLP|Atp6l|Atpl|Atpl-rs1|PL16 |
| Gene, Accession # | Gene ID: 527 |
| Catalog # | ABIN635137 |
| Price | |
| Order / More Info | ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|