| Edit |   |
|---|
| Antigenic Specificity | Aldo-keto Reductase Family 1, Member C2 (AKR1C2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
|---|
| Immunogen | AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK |
|---|
| Other Names | AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2|SRXY8|Akr1c21 |
|---|
| Gene, Accession # | Gene ID: 1646 |
|---|
| Catalog # | ABIN632618 |
|---|
| Price | |
|---|
| Order / More Info | Aldo-keto Reductase Family 1, Member C2 (AKR1C2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|