| Edit |   |
| Antigenic Specificity | CACFD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, WB. Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human CACFD1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE |
| Other Names | calcium channel flower domain containing 1, C9orf7, D9S2135, flower |
| Gene, Accession # | Gene ID: 11094, UniProt: Q9UGQ2, ENSG00000160325 |
| Catalog # | HPA015280 |
| Price | |
| Order / More Info | CACFD1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |