| Edit |   |
| Antigenic Specificity | delta-Like 1 Homolog (Drosophila) (DLK1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DLK1 may have a role in neuroendocrine differentiation. |
| Immunogen | DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
| Other Names | DLK|DLK-1|Delta1|FA1|PREF1|Pref-1|ZOG|pG2|AW742678|DlkI|Ly107|Peg9|SCP1|pref-1|Zog |
| Gene, Accession # | Gene ID: 8788,13386,114587 |
| Catalog # | ABIN635854 |
| Price | |
| Order / More Info | delta-Like 1 Homolog (Drosophila) (DLK1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |