| Edit |   |
| Antigenic Specificity | Keratin 13 (KRT13) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. |
| Immunogen | Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP |
| Other Names | krt13|CK13|K13|Ka13|Krt-1.13|Krt1-13|ck13|k13 |
| Gene, Accession # | Gene ID: 3860,16663,287699 |
| Catalog # | ABIN629751 |
| Price | |
| Order / More Info | Keratin 13 (KRT13) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |