| Edit |   |
| Antigenic Specificity | RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. |
| Immunogen | RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE |
| Other Names | RG9MTD1|rg9mtd1|wu:fb53e06|zgc:103570|HNYA|MRPP1|Rg9mtd1|1300018J16Rik|D16Ertd454e|Rnmtd1 |
| Gene, Accession # | Gene ID: 54931 |
| Catalog # | ABIN633378 |
| Price | |
| Order / More Info | RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |