| Edit |   |
| Antigenic Specificity | Claudin 5 (CLDN5) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. |
| Immunogen | Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN |
| Other Names | claudin-5|awal|bec1|cpetrl1|tmvcf|cld5|cldn5|zgc:85723|zgc:103419|AWAL|BEC1|CPETRL1|TMVCF|AI854493|MBEC1|Tmvcf |
| Gene, Accession # | Gene ID: 7122 |
| Catalog # | ABIN634710 |
| Price | |
| Order / More Info | Claudin 5 (CLDN5) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |