| Edit |   |
| Antigenic Specificity | Claudin 10 (CLDN10) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. |
| Immunogen | Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW |
| Other Names | si:busm1-52i16.3|si:dz52i16.3|CLDN10|DKFZp469F1626|CPETRL3|OSP-L|6720456I16Rik|Cldn10a|Cldn10b|D14Ertd728e |
| Gene, Accession # | Gene ID: 9071 |
| Catalog # | ABIN630264 |
| Price | |
| Order / More Info | Claudin 10 (CLDN10) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |