| Edit |   |
| Antigenic Specificity | Claudin 19 (CLDN19) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). |
| Immunogen | Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV |
| Other Names | claudin-19|zgc:112141|HOMG5 |
| Gene, Accession # | Gene ID: 149461 |
| Catalog # | ABIN634757 |
| Price | |
| Order / More Info | Claudin 19 (CLDN19) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |