| Edit |   |
| Antigenic Specificity | Alkaline Phosphatase, Placental-Like 2 (ALPPL2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). |
| Immunogen | ALPPL2 antibody was raised using the middle region of ALPPL2 corresponding to a region with amino acids SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV |
| Other Names | ALPPL2|ALPG|ALPPL|GCAP|Akp5|C77216|D1Ertd816e|EAP|RGD1565100 |
| Gene, Accession # | Gene ID: 251 |
| Catalog # | ABIN633955 |
| Price | |
| Order / More Info | Alkaline Phosphatase, Placental-Like 2 (ALPPL2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |