| Edit |   |
| Antigenic Specificity | rho GTPase Activating Protein 15 (ARHGAP15) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15. |
| Immunogen | ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ |
| Other Names | pp905|sh3d20|sh3p20|camgap1|BM046|5830480G12Rik |
| Gene, Accession # | Gene ID: 55843 |
| Catalog # | ABIN632948 |
| Price | |
| Order / More Info | rho GTPase Activating Protein 15 (ARHGAP15) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |