| Edit |   |
|---|
| Antigenic Specificity | RAD23 Homolog B (S. Cerevisiae) (RAD23B) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. |
|---|
| Immunogen | RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP |
|---|
| Other Names | MGC107846|HHR23B|HR23B|P58|zgc:65951|0610007D13Rik|AV001138|mHR23B|p58 |
|---|
| Gene, Accession # | Gene ID: 5887 |
|---|
| Catalog # | ABIN631880 |
|---|
| Price | |
|---|
| Order / More Info | RAD23 Homolog B (S. Cerevisiae) (RAD23B) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|