| Edit |   |
| Antigenic Specificity | RAD54 Homolog B (S. Cerevisiae) (RAD54B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. |
| Immunogen | RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT |
| Other Names | RAD54B|im:7137737|im:7153525|fsbp|rdh54|RDH54|E130016E03Rik|Fsbp|RGD1306507 |
| Gene, Accession # | Gene ID: 25788 |
| Catalog # | ABIN634225 |
| Price | |
| Order / More Info | RAD54 Homolog B (S. Cerevisiae) (RAD54B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |